DPCstruct | MC6046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S6XIB8 | 21-137 | GDEEAACCADEILSIHRQLLGLEDLRPGPRTDLLLGRLVAICCQPMSSTTVRMILVSPELQLAVPILRDICSRAESELETFWASEVA… |
| A0A2K2CYK0 | 27-150 | YLASDMEAENQEEVAALVEKISALHAAISKLPSLSPCPEVDALFTELVTTCVPASPVNVIKLGPEAQEMREELIRLCSAAEGHLETH… |
| A0A7J0EHI9 | 5-123 | None |
| A0A172Q4H2 | 2-116 | None |
| Q10MI8 | 156-286 | None |
| A0A3L6DHX9 | 208-319 | None |
| A0A1D6K0A8 | 1-111 | None |
| A0A6A6KJG2 | 254-384 | None |
| A0A0D3FHK8 | 2-116 | None |
| A0A7J0DPT3 | 4-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.