DPCstruct | MC60455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0K9S5 | 8-170 | RKINFFSIILKSFSHNLVATITLCLWAGAFQTASIMLNSINRMDINLKFLMEIDILVELLERPLFRHLHFQMLELDDGFSSEGNGSM… |
| A0A4Y2EC29 | 19-146 | RNQLKDLKTESSWSLFACLYRSWCHSPVATVSLCLLAQTYKHACDLLQIFGDIEVTVDFLTEIDKLVQLIESPIFTYLRLQLLDPQQ… |
| T1KW61 | 146-303 | None |
| A0A6A5DMN4 | 452-626 | None |
| L9KJD8 | 165-324 | None |
| A0A397F1Q6 | 12-203 | None |
| A0A7S2UQE5 | 210-411 | None |
| A0A812LNP3 | 77-236 | None |
| A0A7R9WUK8 | 1-205 | None |
| A0A183TKR8 | 13-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.