DPCstruct | MC6045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 28.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.15 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0063- PF09741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0CKK8 | 21-160 | KSQQVFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVASDKTNTFQGVIFQGSIRYEALKKVYDNRVSV… |
| A0A183JDL1 | 22-189 | QILKKFSQTVYASPSHRQMNMKGSYEEIVYPDLYFTIDNYEEAFGECVLRDSECINVELTAYDRYGRIHGVCFLGTVSYDTIKQFYD… |
| A0A1Y1LJQ8 | 126-319 | None |
| M8AAZ6 | 100-284 | None |
| T1FV44 | 193-378 | None |
| A0A6B0RYP2 | 126-269 | None |
| A0A058Z6U2 | 86-262 | None |
| A0A0P4WET8 | 129-322 | None |
| Q94HW0 | 491-653 | None |
| A0A369S7I3 | 154-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.