DPCstruct | MC60445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0PWV1 | 1-102 | RRAALAHADVDVRLADFLSVDPSQPPYASANSVLLDPSCSGSGIIERSGVSGGGEEGGVAEESDPERLRGLGAVQLRLLLHALSFPA… |
| A0A7S2ZXH9 | 70-155 | QCTRTDFLSIDPASKPFCDVKAIVLDPSCSGSGLVNRVSVSKSSDEEHVKRLDKLAHVQKLLLKHALSFPNVVIVSYSTCSIYREE |
| A0A2G8SPS7 | 7-117 | None |
| A0A3M7KNT8 | 922-1028 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.