DPCstruct | MC60444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183S0T4 | 1-72 | MDSGKSTLISVLTDGELDNARGKARLNLFRHLHEVQSGRTSSLSRELLGFDINGNVTNYKYADGRVYRRSTE |
| A0A0D2VT64 | 365-457 | VRVAVVGNVDAGKSTLLGVLTHGELDNGRGKSRLRLFRHKHEADTGRTSSISHNILGFDSQGRIVNAPDEHTGGLDWTLICERASKV… |
| A0A225AKI8 | 193-282 | None |
| A0A433DKM0 | 202-294 | None |
| A0A0G4L0U2 | 290-371 | None |
| A0A3R6Z2B3 | 1-80 | None |
| A0A821SZT6 | 145-228 | None |
| A0A7S3GA31 | 144-236 | None |
| A0A3Q0JHC9 | 151-239 | None |
| A0A1Y2HQP3 | 171-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.