DPCstruct | MC60438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 166 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0039- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8N800 | 37-192 | ASRPYFQVFRDFHARISPSNSEDTPTSSKELLSLCDRLRDVELFDLGIYLEDRENKPALVRPVTRDLLQSREEHARKMLLKQQEKEK… |
| A0A183RS39 | 32-192 | NFLHTLVSVRNTMKKILSSGSITDSSCKKRLYEACDRFRDIDLVNAGIRLQDRATAIDLSRGLDISPFIGLVDKKFLISEHSESKTK… |
| A0A7R9WSW9 | 1-198 | None |
| A0A146K5B0 | 16-175 | None |
| A0A7R9U2B0 | 40-222 | None |
| A0A084RTR0 | 308-458 | None |
| A0A7S1GMW5 | 21-233 | None |
| B0ETY1 | 86-247 | None |
| M1V4Z4 | 466-636 | None |
| A0A482VIG9 | 1065-1220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.