DPCstruct | MC60437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 116 ± 31 aa |
| Standard deviation of domain lengths | 31.17 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 93.10 |
| Assigned Pfam label(s) | PF00566- PF07970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183RPJ2 | 10-116 | LKRPNPISLPPMPTVQRSLPLNMTQWKRSLDPEGRVNRPENLREIIFNGGIENDLKPIVWKYLLGYYQWTYTAEENERLKAEKSREY… |
| A0A2R8QAX8 | 18-127 | DLGPRPEMQRTGPVTMEEWAKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTDEYFRMKLQW… |
| A0A446N4Y8 | 291-380 | None |
| A0A7M5WZB6 | 95-205 | None |
| A0A3P9K8P7 | 253-390 | None |
| A0A814VXE1 | 165-290 | None |
| A0A3N7G3S6 | 16-117 | None |
| A0A672URZ6 | 371-501 | None |
| A0A7J0G9G1 | 524-613 | None |
| A0A842Z0Y4 | 250-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.