DPCstruct | MC60435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5QW07 | 18-91 | ADVQRVVGMKWWKPKASEELCNRLLHTIYMGVSGYSSEKTRSRAHRLADTVAANHTGMNIDHIFQAERNLSLQY |
| A0A5F4W7X9 | 383-453 | GNQEVLADVRTIVNQSSYTPQDPRDLCGRILTTCYMASENSSQETCSRARELAQQIGSHHISLSIDPAVKA |
| A0A3M7PN21 | 686-764 | None |
| E2LHM8 | 72-145 | None |
| A0A1I8F9M4 | 180-259 | None |
| A0A842ZIC4 | 1-95 | None |
| A0A7D8YSB3 | 136-209 | None |
| A0A822HW39 | 200-275 | None |
| A0A067DB22 | 119-223 | None |
| A0A7T8HL04 | 51-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.