DPCstruct | MC60433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Standard deviation of domain lengths | 19.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183RGG0 | 238-375 | RMICTNTGQMCLWEREKFMTRRFLMQDMYQKSLNKQLEDYLQESDPFWEPLEDLFIGIAPAFLRALAYRLDVDEELKIMDFIGDELG… |
| A0A2C9LBM5 | 31-167 | KEGMSEVMVQLRNLENGNSWLLSRNNFINRKYLMQEMFQNYTEGDPDWNVPKEKDPFWEPVSTPVLIGTSLVYLQPLAYLIDMDESL… |
| A0A5A8BZD2 | 357-529 | None |
| A0A7D9LLU1 | 6-161 | None |
| A0A7S4ID28 | 3-127 | None |
| U6K636 | 18-125 | None |
| A0A1S3J029 | 88-243 | None |
| A0A5K3ENU8 | 424-558 | None |
| A0A5K3EQM3 | 165-299 | None |
| A0A5A8EAJ8 | 261-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.