DPCstruct | MC60432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183REP6 | 17-88 | RTVLYACERHQCILPNCQRAGFLIGCGADVRKSSTVAGILYENYLRQRKKAIWFSVSNDLKAGAQRDLHDVS |
| K7H651 | 354-427 | QLEAVIYACQMHERRMPSGERYGYLIGDGAGVGKGRTVACIIFENYLQGRKRAIWLSVSSDLKFDAERDLRDCG |
| A0A183M7Y0 | 58-134 | None |
| A0A3P7FTG9 | 304-377 | None |
| A0A2G9SLP2 | 289-362 | None |
| R7U7D3 | 11-83 | None |
| S4RS05 | 299-372 | None |
| A0A6J2YGR4 | 179-252 | None |
| A0A6P8IIA6 | 103-175 | None |
| A0A817D312 | 219-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.