DPCstruct | MC60430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 291 ± 56 aa |
| Standard deviation of domain lengths | 55.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R880 | 10-276 | TSAVKSRKKFLSEKESTHKIKHLKILIDSLSDDELQPFFVENSSLIFQVFSDCFFSFEWDVKLKGSSNCIKELEVVLTVFEKVLLLL… |
| J9EQJ9 | 9-297 | ADFTASLQRFADLHRDCASRAKHLKLALDALCIKDKRQFMEDYSFETFHLVDELLLQADLTQTAQSVLEVESALWTLEQLLCLAPGL… |
| A0A177BF58 | 1-269 | None |
| B2RX86 | 9-354 | None |
| A0A7J7KH67 | 1-272 | None |
| A0A183WMN1 | 3-274 | None |
| A0A814U0J0 | 1-194 | None |
| A0A819NNC3 | 1-271 | None |
| A0A1I8HXZ9 | 14-368 | None |
| A0A0K0EHQ4 | 373-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.