DPCstruct | MC6043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1623 |
|---|---|
| Mean domain length (aa) | 169 ± 35 aa |
| Standard deviation of domain lengths | 35.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.26 |
| Pfam Score | 88.76 |
| Assigned Pfam label(s) | CL0274- PF18052- PF14389- CL0063- PF10536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TFC4 | 50-156 | RAYAEKQDGVVVKPEIGTSFDSLDEGFQFYNLYSWEVGFGVRFAKSRLNVERRKCMQEIVCACAGAPLKENSRSIRTGCTAMIRFLR… |
| A0A2K2CGN8 | 9-180 | MQAPELPKNLIPIVGQHFSTFDEAFKFYNAYAKHTGFGLKRSQRNTYRSYIRCTREGKYTTSVRDGERQRDRARKKIGCKAHMGLKV… |
| A0A067BZD2 | 3-108 | None |
| A0A0D3CXR2 | 272-454 | None |
| A0A811MZS0 | 1041-1242 | None |
| A0A811MNY8 | 875-1069 | None |
| R9P3T8 | 70-246 | None |
| A0A6S7FSI5 | 317-503 | None |
| K4A1N4 | 1-153 | None |
| K4A1I2 | 2-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.