DPCstruct | MC60429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 48.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SK56 | 39-105 | MPDIEKLKQPWPVEIDKVLSEIKLPSANLDVDLATYIDIICAIFDIPMYQSKIETLHVLFMLYLEFK |
| A0A183R875 | 1-71 | MPEISELMAVWPTSFEDTINNMQLSLSQLDCSLKDYVDIICALLDIPVYNNRIHSLHLLFSLYLEFKNSQV |
| A0A2A4JU25 | 444-518 | None |
| A0A3P7HF70 | 209-286 | None |
| A0A504XDT4 | 331-405 | None |
| A0A132AM22 | 178-246 | None |
| A0A5F4C4Y6 | 500-570 | None |
| A0A0R3SI26 | 122-200 | None |
| A0A077Z1Q3 | 71-150 | None |
| W6KHC2 | 126-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.