DPCstruct | MC60420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 222 ± 48 aa |
| Standard deviation of domain lengths | 48.49 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 93.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3BEU3 | 7-280 | DSESYGESKHGVIYQKEEDHFDFNRPLSEVRPGKDYRTPTCQFCHMYEKHGRFIHNPVMKGIWRMGTVPPKNLEYTSSLKDYPYGIK… |
| A0A1F9DK08 | 5-199 | SLHGTIYKLTQNPDRAPRCITCHMPKGTHDSSFGIARGPAGTRSEVVNLKEVPISKEEEEKKREEMIRVCTGCHSRRFAREQLENAD… |
| A0A0M2URA1 | 553-838 | None |
| A0A661NSC1 | 278-521 | None |
| A0A0S4L3Q0 | 260-527 | None |
| A0A4U1A2M0 | 172-414 | None |
| A0A6S6M4Z4 | 48-285 | None |
| A0A3M1QHX8 | 5-134 | None |
| A0A1E2UVC2 | 173-429 | None |
| A0A661D7C8 | 230-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.