DPCstruct | MC6042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 306 ± 43 aa |
| Standard deviation of domain lengths | 43.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0IFZ7 | 2-268 | QLIINKLSNEALHSVANIATHNRVSFEKTRPAMKKIIEDHLPQYLANLHDENDMSQLSHILTNPFSYRSNSLNITTPISPKMLSSID… |
| A0A0Q3MD88 | 1-352 | MFPVDPSNQSFSKLSTWLNRMPRAVEVSSEGVRFYVERSFGLQSNCYKHHVVKDGRDLFKLQKQKDGSLCPESFKILHCTIQKLSNE… |
| A0A6P5T190 | 1-249 | None |
| A0A6P6A9V1 | 64-376 | None |
| A0A5A7RJE2 | 75-390 | None |
| A0A0E0K259 | 10-333 | None |
| A0A438DFU2 | 14-326 | None |
| A0A833VYV8 | 5-268 | None |
| I1NPY2 | 16-337 | None |
| D7T2A1 | 1-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.