DPCstruct | MC60401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 149 ± 33 aa |
| Standard deviation of domain lengths | 33.12 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF03638- PF01151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9LX82 | 11-147 | GCDTVSCFYNIGKLKHFKLLNQYPELQGIVNVFNCPNSIPEKIFKAGERYTLKLYGAPQSQTNIDEYRYLLFTRKTAGNKFKLASLP… |
| A0A7T8GVU8 | 2-107 | FHALTGCDTVSSFARHGKKTAWAVWTVLPELTEALIQLSSAPSDIPNDAMCIIERFVILLYDRTSKCTDIDKARWKLFARKNNVQLI… |
| A0A819ZM10 | 6-191 | None |
| A0A6S7H0Y5 | 125-273 | None |
| A0A2G8LLF9 | 26-177 | None |
| A0A7M5V9H1 | 2-142 | None |
| A0A7J6CW94 | 188-369 | None |
| A0A4Y2D4U4 | 64-157 | None |
| A0A6A4JXV0 | 35-165 | None |
| A0A817R3U4 | 320-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.