DPCstruct | MC6040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 330 ± 75 aa |
| Standard deviation of domain lengths | 75.16 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NZQ9 | 3-194 | LVSTIQFVTSLQTAKQPLLEAGYSVTIPQCLPLSPGEILGCTSPKVEGVDALIYVGDGRFHLESIMISNPLLAAYRYDPYNKSFTRE… |
| F2HHW0 | 95-419 | FEYVKTISRLNNSKYKKIFVQFPDGIREYNIILNSLFQLNSRRICQVLNLGITSYGACCIEDYFAKFLGTCVVLHYGHSCLTPISES… |
| A0A177WJM4 | 353-728 | None |
| A0A1E7FZP2 | 44-410 | None |
| A0A6P6FXH8 | 192-491 | None |
| Q8ZU11 | 22-292 | None |
| A0A2P8YET4 | 74-337 | None |
| A0A383WIQ3 | 2-449 | None |
| A0A2H9TG46 | 23-291 | None |
| M3SAN0 | 8-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.