DPCstruct | MC604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1233 |
|---|---|
| Mean domain length (aa) | 176 ± 26 aa |
| Standard deviation of domain lengths | 25.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 97.75 |
| Assigned Pfam label(s) | CL0125- CL0268- CL0108- CL0159- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6ZX81 | 5-159 | GIVNGVTNTTFEPNRSITRAEFCKLIATTFGFSEIDASSSYTDISQTDWYYATVMTAAKAGVVTGYTDGDFRPDNQITREEMAAMLI… |
| A0A3S4YI38 | 6-132 | YRLAGSPEVALPETSPFKDVDSSHLFYKEIVWMSQQGITTGYEDGTYRPNASVNRGAMAAFFFRYAKVTNYEAPQTPQFKDVDRNNP… |
| A0A2T7TN16 | 440-621 | None |
| K2B3X6 | 925-1106 | None |
| A0A516KJP3 | 538-714 | None |
| A0A516KJB4 | 29-215 | None |
| A0A516KD69 | 37-225 | None |
| A0A1R4HZP2 | 346-536 | None |
| A0A7U6JIH2 | 1090-1268 | None |
| A0A1M6KFQ2 | 191-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.