DPCstruct | MC60396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9BZM8 | 2-157 | RIMHDNDVKIRISNYGRSLDKLAELTKKCDKFGVQYSMYDFATGKTRWFQCGGVDFKREQNNRTVKKRFNDCRFNTCLTLERGELSH… |
| A0A1Y2P817 | 5-134 | WENINQKCKEYNITLSFFNDENIEKTSFKTALNLKGDSDPFDNFTICHRANIRIQIKDGIVYPCPIVANIKYFNSYFKQNLQISNRD… |
| A0A099UC68 | 106-257 | None |
| A0A7J0B8R7 | 2-117 | None |
| A0A7X5I3A1 | 1-195 | None |
| B8FVR6 | 482-633 | None |
| A0A3R6FQH7 | 121-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.