DPCstruct | MC60390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9B6A8 | 1-81 | MGNENRMRVCPVCGKHYTDYPATSRRDNKTLICPDCGTREAMQDSEISTDKQKEILDMIHKYSGKCETGMEEERGEEEDGK |
| A0A3A9EWI5 | 1-59 | MVCPKCGKPYRGAPAISRDNTRLICPDCGTREALEGLGLSQEEQEHILGNIHRYQEEQE |
| A0A1Q6KHP3 | 13-78 | None |
| G9PX70 | 1-69 | None |
| A0A1V5GRH3 | 76-132 | None |
| A0A662ZH01 | 50-115 | None |
| A0A414ASZ7 | 73-129 | None |
| A0A417D1N0 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.