DPCstruct | MC6039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 638 ± 64 aa |
| Standard deviation of domain lengths | 64.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1S2S0 | 268-837 | GLLFDVPDKLAGKAASITLSAVRKDDQSQRCVPTFQNTTKQLAFWSDYLSPDAVALVGSPKVTVESSVIGTSAQDATSIPLSFNSQG… |
| A0A1Q3VQJ2 | 64-759 | SVALRGSGSGTVGYRWLAGTANLTTFGAKVGIDNRASKTPAPGYRYQVIVDARNDAGGVTSISVNRDTSGAGTAYSSLISVPNIYDA… |
| C6RCS3 | 606-1265 | None |
| I1DRC8 | 435-1098 | None |
| A0A7H4GR14 | 668-1192 | None |
| A0A521ZYV7 | 18-638 | None |
| A0A5J6P6J2 | 308-1024 | None |
| A0A7Y3HIJ8 | 344-972 | None |
| A0A537CAY3 | 15-750 | None |
| A0A357LZS0 | 492-1044 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.