DPCstruct | MC60388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 477 ± 85 aa |
| Standard deviation of domain lengths | 84.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8U515 | 122-605 | DPETSMALASMGVKQCFNAPQDRLKYKGSDTKYQWGGHHWSMTTWNKVHIMKSVYEMGVHVVHSDMDVVWFNDPLPYFKSLLEKPVH… |
| R1F5W9 | 79-688 | GNSGATEMLLNWVHHVIALRKGHAMVVACYDDGLFVHLRRLRVPAYNYSGALPPVHFRGTPFLFHRMGFLKAMTIKEVLLSGRHVLV… |
| M7X3X2 | 157-748 | None |
| A0A2S5BBW8 | 704-1158 | None |
| A0A7S3BL78 | 181-796 | None |
| A0A7S0J692 | 109-663 | None |
| E1ZAF1 | 9-473 | None |
| A0A7S4C726 | 59-609 | None |
| A0A812Q8Y2 | 152-572 | None |
| A0A813GLX6 | 9-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.