DPCstruct | MC60384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 178 ± 31 aa |
| Standard deviation of domain lengths | 30.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 94.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0YSF4 | 1-172 | MSLRFNYSRPDMELKTGTLDQVNVGAPTEMLLHTIDVGMLIENRGRFEFQYDKEHARQYFQTLPASRLVVSIYEPQHFEEIMMYDGT… |
| A0A376SCB6 | 43-278 | PGLNLVIKQGNLSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNYAPLHLKEVMLPTGELLT… |
| A0A655X3L5 | 124-331 | None |
| A0A7X9Q5M5 | 259-389 | None |
| A0A1E7F879 | 478-653 | None |
| A0A7V8P7D3 | 194-340 | None |
| X0SDS8 | 104-260 | None |
| A0A0W0PED7 | 353-596 | None |
| A0A833AAX0 | 194-369 | None |
| A0A140NSV2 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.