DPCstruct | MC60382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 208 ± 34 aa |
| Standard deviation of domain lengths | 33.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9TFA4 | 1-164 | MFNGLIPDRPLGDRAFWARPVRGDTSATLWNGTHAYHELPRVLDLPNGWVQNANEPPWTATVPVLLHPDAFPAYMAPRGMGLRPQRS… |
| A0A376L2N5 | 76-265 | ALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGG… |
| A0A6I7WLP2 | 230-435 | None |
| A0A1V5Z5J2 | 2-194 | None |
| A0A418W9A2 | 356-579 | None |
| A0A1F8PB66 | 206-412 | None |
| A0A2V7WUJ9 | 63-284 | None |
| N9SJR1 | 429-610 | None |
| A0A7C7QE08 | 2-197 | None |
| A0A7C1W8Q0 | 309-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.