DPCstruct | MC6038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5WY26 | 16-99 | FDTMKDMAKDDPEGFERIRQQMIDELIDDAPEANRRRLIGLQWRVDQERLLARTPMGACIRISNMMWESVTGEGGLLEQLNRVS |
| A0A1Q3VPM8 | 2-117 | VQTRTEDGGFNFQEWAELAQRDPVAFEIRREQAISRFLGGASPKQRRRGTLLQREIDAARKQAGDPRKSLLILARMMCQELSFLGEG… |
| A0A7X1TUG6 | 1-102 | None |
| A0A6N6L7D0 | 1-112 | None |
| A0A1D9BDV1 | 7-103 | None |
| A0A1B3LPA6 | 4-103 | None |
| A0A371CGB3 | 78-173 | None |
| A0A2A4WMR7 | 21-127 | None |
| A0A1E2UMM6 | 1-108 | None |
| A0A558DRP8 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.