DPCstruct | MC60362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7XMU6 | 4-84 | EAVNIRILDREYTIGVAAEERDQLIAAARLLDAKMREIRNANRMASVDRVAVLAALNLAHDLHQSRQEQEARDHEIAHTLR |
| A0A3D4GY29 | 5-97 | DDKKTEITEVTIFGREYPLHSDESDDYTRNVAQFVDKRMYEIASEQNLADPTRIAILAAMDIADRLLKKRNARAVGEDRTSQAINRL… |
| A0A2R4N285 | 1-74 | None |
| A0A3D0EFV5 | 1-77 | None |
| A0A6A4UN54 | 7-73 | None |
| A0A1Y4NBG5 | 4-96 | None |
| A0A3T0K9Q5 | 1-103 | None |
| A0A248L8P3 | 14-88 | None |
| A0A3E0QU11 | 1-80 | None |
| A0A2V8SCQ0 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.