DPCstruct | MC60360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4GWH0 | 5-100 | ARRRNKRPQASHPAHLAAVAGLGCIICGRPAECHHVRQMSGMGLRPSDLDAIPLCPDHHRTGGYGTAVHAGRRAFARNFGSESDLLN… |
| A0A2S5LBZ3 | 2-89 | TNKERYHLSQVAMLGCIICGNIPEIHHVRHGMGLGQRNSNFNVIPLCHVHHRTGGFGVAFHAGKKTWQENFGTELELLDKVNEKLRLA |
| A0A3S3BKU1 | 67-176 | None |
| A0A0F9HEF9 | 1-96 | None |
| A0A3C1GIU5 | 2-94 | None |
| A0A2X1C741 | 25-133 | None |
| A0A3C1F5U6 | 51-149 | None |
| A0A3C1F5V3 | 6-120 | None |
| I0QPV8 | 240-332 | None |
| A0A7W0IYX6 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.