DPCstruct | MC6036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 194 ± 15 aa |
| Standard deviation of domain lengths | 14.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812A1H4 | 84-275 | SGRYGGAKTMNIGMNLEIHFHQQDEASVYLESDAIGKDEKFGEILLFCCFALRTMSNFGRCSIASSLATRLSQIGDNLIELSNLHSP… |
| A0A1F6FXA4 | 13-192 | LVATVRIKFYGEDEASVEYTTDVSDQEQKEMDMIQVFALYYSKMLYNLNRGEIADNLVLYIKKATSDLIVQGEGLKRPSILSSGQKL… |
| A0A1F8SY58 | 176-395 | None |
| A0A7C6YSA8 | 1-180 | None |
| A0A538H6W1 | 1-194 | None |
| A0A3M1FJK6 | 5-207 | None |
| A0A1F9DVK9 | 2-174 | None |
| A0A1G1YI70 | 15-226 | None |
| A0A1F9BJF6 | 9-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.