DPCstruct | MC60350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 357 ± 60 aa |
| Standard deviation of domain lengths | 59.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 82.97 |
| Assigned Pfam label(s) | CL0205- PF03722- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084W7C2 | 68-416 | LRIPMSLGRQEQFSLFIPRHRKIAARLIDIFMGMRNVEDLQSCAVFARDRINPYLFNYALSVALLHRKDTHDLDLPTIIEVFPDKYV… |
| A0A182SV15 | 4-336 | LTQKFHGLLQHPLEPLFLPKNNGTLFYELPERFLTPRYRPIGQNLVNRFGPNSAASTEVSNDTGVPPMVVTIRDLKELPDLSFATWI… |
| A0A7J6ZUB9 | 22-394 | None |
| A0A7R9FWB4 | 34-539 | None |
| A0A6L5CZ75 | 14-307 | None |
| A0A5B7CRV4 | 30-478 | None |
| B4IPC2 | 1-356 | None |
| A0A482WS29 | 62-599 | None |
| Q5AR52 | 24-389 | None |
| A0A226EMK4 | 1-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.