DPCstruct | MC6035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 221 ± 45 aa |
| Standard deviation of domain lengths | 45.46 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7GEU5 | 54-261 | VGAAVTWGLGWRGLMLLLAFFISGSVLTQLAGGEGGQRNLRQVIANGGVAAAAALWGRWSIAAAALAAATADTWATEIGAFSPTPPR… |
| A0A1H1XDG5 | 17-213 | RKLTLTGAITGWVVAAVIYTGAGYTSISLLAAFFMLASLATKGKGSKRTSGQVLANGGVSAILGLCACIWPQNQTLFQLMIAGSLAS… |
| A0A4P9Y4I8 | 20-281 | None |
| D0N9S5 | 588-849 | None |
| A0A498N740 | 23-275 | None |
| A9T3B8 | 30-245 | None |
| A0A6V7PTH4 | 79-316 | None |
| A0A7R8X0D1 | 956-1225 | None |
| A0A449BIH7 | 22-256 | None |
| A0A7C1KVH2 | 3-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.