DPCstruct | MC60345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9RY83 | 53-135 | AVRAESASATSAQSFSVAQSAPAGQGNRAGRPPREALDACANVDPQSACSFNNREGETVQGRCMSPKADVPLACVPANPPKNG |
| A0A1G8T2P3 | 14-99 | SRLIAIAVTVAMAGLLIGIAQAQQSRQGRPDGAPPEALSACSGKSTGDACQMTIRGKGDSASGQCIDTPDNNVACLPEGAPQPPKS |
| K4KM14 | 7-74 | None |
| A0A4U0ZRP1 | 2-68 | None |
| A0A0N8HHI0 | 10-107 | None |
| A0A7V4FYP4 | 1-79 | None |
| A0A444JHC0 | 10-82 | None |
| A0A162Z7I2 | 31-123 | None |
| A0A1H3W7L2 | 2-84 | None |
| A0A1V4XHJ3 | 8-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.