DPCstruct | MC6034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DNX8 | 6-66 | IGRIGFYYLTPDGREGGVWSAQSGEWQSLDDEYLREVRSGLRMAEDQRAPDLLTLPLSISV |
| A0A7W4GI03 | 3-63 | DFFNLGRVALYAQSLDQKIAWMYDADAKSWNKLDDSYLRDITKGIRIARKQGALDLFALPI |
| A0A7V2AD00 | 48-113 | None |
| A0A090P493 | 78-146 | None |
| A0A657AKE9 | 154-213 | None |
| A0A3C0T680 | 125-188 | None |
| A0A328XVY0 | 219-293 | None |
| A0A2E9RLJ9 | 187-250 | None |
| A0A836U405 | 32-93 | None |
| A0A2E1CLW0 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.