DPCstruct | MC60339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9RKM1 | 31-141 | QFSTSEVSTGMFWIDDKPVFRKVVDTGALPNSTQSLVAHNIASPNLDAVLFIRGFAEDTNGNQIPLPHVDVGNEAAGDVGVAVNDTV… |
| A0A0F9LYZ1 | 91-190 | FTMLGSDAPKIKMKKLTGTTGGTEGDQTNITHGLDRSKIIGCQVLVTAANNNRILPAFIEVDEYEYSVFIDATNVRIDLHATNSNSI… |
| A0A843GU58 | 361-469 | None |
| A0A537IPF9 | 637-753 | None |
| A0A1M7CNN7 | 438-565 | None |
| A0A2X2X2Z7 | 257-369 | None |
| A0A378RL72 | 317-423 | None |
| A0A843GMQ1 | 151-263 | None |
| A0A843HCT7 | 85-194 | None |
| U2RH76 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.