DPCstruct | MC60334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545A5U9 | 17-138 | DTKNASGEEVNSYILTKIHSYEKYNTINTNLWEQVQEDFKNLSVETFKLATLRIIQNLRDCLLSRGVFVNRNDKRKTTAQTFCECIF… |
| A0A2S4PJB5 | 3-145 | TKPNINGYIIWVMKIWKDSEYRDEALIEAFQEDFAEWTTEIFDVADRLLLRDLRDHLRKNGVFTECKPGIKYAKQLENILKQDVNHN… |
| A0A395J5F1 | 43-257 | None |
| A0A2J6QFD2 | 4-172 | None |
| A0A3D8QAR4 | 10-160 | None |
| A0A0F8A431 | 13-211 | None |
| A0A6S6VGU6 | 1-221 | None |
| A0A420HBK5 | 1-145 | None |
| A0A420HN53 | 19-166 | None |
| A0A420HJS0 | 11-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.