DPCstruct | MC60332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 201 ± 24 aa |
| Standard deviation of domain lengths | 23.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11678 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2T953 | 33-241 | RPDDVTKNVALGNQYAKFQWKDVATTDDPGASIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDE… |
| A0A1I4NT12 | 519-765 | SMVEGAQADDQGRPGAREQVDPIDAAIASTSKYGVNQVWDCIADPTHKADFSQRDEAASSQCPQLYKGYVAQAMGYEHTVMEELNRN… |
| A0A3M5Q4A5 | 132-336 | None |
| A3RWQ1 | 5-189 | None |
| A0A2G8T1Y0 | 185-395 | None |
| A0A3C1Y3P1 | 21-221 | None |
| A0A3M5ES56 | 68-279 | None |
| A0A1X1PGI8 | 99-296 | None |
| A0A2S4M7G2 | 92-259 | None |
| A0A6I3XIW4 | 72-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.