DPCstruct | MC6033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 254 ± 49 aa |
| Standard deviation of domain lengths | 48.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5WDB4 | 6-202 | NSIWFLLQQNALGIALKQAAIMVNIDLHDADIIINRARKVANVTSSHDNPRFIGTNGLPKSIQYKSDYRLLSSLQSSAQKLRDNSLD… |
| A0A7W4C839 | 55-293 | VDSAQVHAIKSSETVRNGRIDMAICQRVLQNIDEGMAPEQLAHNFRIPAETINKWHKNAIVLSLQQTTYHQPRHRKKDLFEIAPTIP… |
| A0A7X8YIS5 | 87-457 | None |
| A0A2D2E9I0 | 220-475 | None |
| A0A7R7ZBD5 | 325-618 | None |
| A0A522LTT3 | 756-1032 | None |
| A0A1Y0D419 | 214-378 | None |
| A0A0G3GC56 | 307-617 | None |
| A0A7Z1YDD9 | 263-531 | None |
| A0A7U6LKH5 | 12-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.