DPCstruct | MC60329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 212 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.64 |
| Pfam Score | 73.05 |
| Assigned Pfam label(s) | PF13363- CL0369- CL0036- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X3P9D4 | 4-197 | DGESGWLFLSTYRPHGHLDPQPQLQLHLGAREGLRRPQTVPARPIDLPAGVSTVWPVNLPLGGPEGPVLRCATAEVLTRRRIEGGSA… |
| K9GCL7 | 342-544 | TNLYVVRHADFTSTGSTQYTLTLSTSVGQIEIPQLGGHLTLNGRDSKFHVTDYDVGGINLIYSSAEIFTWAHGSGSTRVLILYGGAG… |
| A0A0G4NES1 | 161-363 | None |
| A0A3R8KGN5 | 1-222 | None |
| A0A3C1BIH3 | 1-191 | None |
| A0A2H3D2I7 | 2-185 | None |
| A0A2H3D7D3 | 16-274 | None |
| A0A124GTI6 | 3-210 | None |
| A0A2B7Z567 | 140-365 | None |
| A0A1V6YEG2 | 70-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.