DPCstruct | MC60321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3UD19 | 15-103 | LPEGTELHPVIAAFEKSDEPTVVIEGFIGTGKSGVVRLYAALDVDTYVEIPESAIVHREADKAQPGFMRAYVRSDSRVMSVTRERLP… |
| A0A7Y5XGS8 | 1-91 | MPSSGRSEFEVNPLLARLLSHGGEPCVFRGYVGPSDNEDTIRLYPSLGRLNFSVEIRVSDIVETAPAPKAALPHDGTVVWVRNDADV… |
| A0A3M2C3R0 | 1-102 | None |
| A0A143PL40 | 3-153 | None |
| A0A0G2ZVY2 | 14-154 | None |
| A0A0A3XLV6 | 1-133 | None |
| A0A2S9YTH3 | 1-117 | None |
| A0A7V9UDA3 | 1-107 | None |
| A0A1A0TIM2 | 1-122 | None |
| A0A4P7GLK1 | 7-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.