DPCstruct | MC6032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20332 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1AVL2 | 6-117 | TPYQTVLAKMISTETVIEAGKAHEARMYVNSVLAREDVMASLLSQGIDMTEAKARVDNLTDSEIVSLADQIETAPAGGGAIGIIVGA… |
| A0A7W4C4U4 | 4-123 | VLVVAAVMLTYLTCISTAHAGIVSSEQVIVQQQNIYNKQQVISMLDNVEVQNKLVALGVSLADAEMRIASMTDQEINQLNTQMNDMP… |
| A0A6N7FC92 | 119-252 | None |
| A0A1G9TKB0 | 1-100 | None |
| A0A7Y0HEN5 | 10-130 | None |
| D3SC86 | 26-137 | None |
| A0A149W0C4 | 4-131 | None |
| A0A5Q4F0T2 | 1-102 | None |
| A0A848Z1C3 | 62-186 | None |
| A0A0N1AHF8 | 27-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.