DPCstruct | MC60318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 183 ± 18 aa |
| Standard deviation of domain lengths | 17.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N9N759 | 27-217 | QLVAGGLMLVFAGLAFAGKERLNVWISLWLALLWIGTGVVYHWLFYSEINAAAKYYALGFVLQGLLIVYEGIKEKNLWFGYRGGYCA… |
| A0A0P0YYT9 | 36-235 | PVVGIAAALACLGLGAARHRWASPASAALLAAAFATSAWLFFFGVYATINWAAIYSGWTFVAEAALLLVASVVLGRYAQPRISVSTP… |
| A0A2E4DE68 | 7-189 | None |
| A0A497IAY7 | 22-202 | None |
| A0A6L7XPP9 | 34-223 | None |
| A0A1Q6FWZ7 | 19-215 | None |
| A0A2V7W8U3 | 1-150 | None |
| A0A2A2I401 | 1-175 | None |
| A0A6P2BZU2 | 35-242 | None |
| A0A0G0NG99 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.