DPCstruct | MC60316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 608 |
|---|---|
| Mean domain length (aa) | 210 ± 45 aa |
| Standard deviation of domain lengths | 44.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 98.97 |
| Assigned Pfam label(s) | PF01529- CL0111- CL0020- PF14964- PF05485 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5PRE0 | 17-201 | HVSVLHFSVVLWLFWKLLTQDPGRLQAADADPRFSSIADLVESNENPNRFCIYCELFQVANCKHCRLCDFCVMDYDHHCLFLNHCVG… |
| A0A7J8E010 | 1-137 | MFVWSYWMTIFTSPASPSKEFYLSSSEKERYEKEFSQERQQEILRRTARDLPIYTTSASKTIRYCERCQLMKPDRAHHCSACDTCIL… |
| A0A6A4PXV3 | 227-493 | None |
| A0A7R9KH09 | 272-449 | None |
| A0A7R9KHX2 | 183-401 | None |
| A0A7R9KM18 | 2-267 | None |
| A0A7R9KU12 | 389-643 | None |
| A0A5N5THH8 | 19-221 | None |
| A0A1A8YVQ9 | 294-480 | None |
| A0A7R9Q4L4 | 17-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.