DPCstruct | MC60315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 155 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 50.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5PC80 | 6-173 | NKLVFIPVLAVLFVMIGYQYICPAGSQSCHLRNGGEPSARHAAVTDEAAHVERELAHDAASKYNFSERELARRVDFDMKGDDVLVFL… |
| A0A6E8VA79 | 2-99 | NDDFQFDMNAHDVMVFLHIQKTGGTSFGKHLVRDLDLKRPCTCQRKKKRCYCFRPHRNENWLFSRYSTGWKCGLHADWTELTGCVDQ… |
| A0A5J5CNS6 | 1-174 | None |
| A0A4Y7LP44 | 22-184 | None |
| A0A4W6DIT4 | 1-182 | None |
| H3BEX2 | 1-104 | None |
| A0A1W2PQ14 | 2-172 | None |
| A0A091E535 | 117-270 | None |
| A0A5E4Q435 | 29-174 | None |
| A0A2G8LK74 | 37-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.