DPCstruct | MC60314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 155 ± 31 aa |
| Standard deviation of domain lengths | 31.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.63 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0113- CL0020- CL0363- CL0307- PF01294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8P8M5 | 2-129 | VKHNNVIPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPVVHGQTLKYNMKLRAGKGFTLEELKAAGISKK… |
| A0A5N5MVK5 | 3-179 | PSRNGMILNPHFHKDWQKRVRTWFNQPARKLRRRKARVRRSATTTRSAPAGFSLEELKAAGISKRVARTIGIAVDPRRRNRSTESLH… |
| A0A4T0HSH7 | 49-245 | None |
| A0A2H9TP02 | 9-199 | None |
| A0A2K6GF59 | 2-158 | None |
| H2ZVP1 | 4-124 | None |
| A0A5F5Y728 | 3-146 | None |
| A0A0D2NFH5 | 238-355 | None |
| L5K7E0 | 7-150 | None |
| A0A182TII9 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.