DPCstruct | MC60310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 3 aa |
| Standard deviation of domain lengths | 3.27 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S3RMC5 | 1-81 | GGFGVAKNLSDFAFNGAESTILEVLKTSCQAFNQLGKPIAYLCIAPALIGHIHPAGTLATIGNDEATAQAVEALGASHVAC |
| A0A2E5K2E9 | 94-175 | GGFGAAKNLSTFAVDGAGCSVDESTAEFLERFHGAGKPIGFACISPAIAAKIFGDKGVQLTIGTDEGTASALESVGAKHISC |
| A0A4W2I764 | 313-401 | None |
| A0A673GXG2 | 49-135 | None |
| A0A834CLX0 | 73-164 | None |
| A0A498LKP6 | 106-197 | None |
| A0A1I8G132 | 133-221 | None |
| A0A811UBD1 | 501-586 | None |
| A0A3R6ZF68 | 530-617 | None |
| A0A812ZRP3 | 822-904 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.