DPCstruct | MC60309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 199 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8Y0E1 | 105-290 | MCELCFLHNMAVEAISQMRRHQAVFFVGPSGTYPTPQLANIELQLWNAKQCWHFAQLFEQAVVNGLTALATLNPGTHLDLAASLYSS… |
| A0A1I7WZ19 | 1-187 | MCELCFLHSMAVEAINQMRRHQAIFFSLYPGVYPTPQLASIEQQLWKAKQCWHFAQLFEQAVVSGLTALATLNPGTHLALAASLYSA… |
| A0A1I7SPW0 | 267-479 | None |
| A0A0D6L5E1 | 265-469 | None |
| A0A7R9MF70 | 136-345 | None |
| A0A3P6RB92 | 1-212 | None |
| A0A1I8CMJ7 | 269-483 | None |
| A0A0N4U2A7 | 103-310 | None |
| A0A368FUT9 | 239-398 | None |
| A0A034VBE3 | 105-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.