DPCstruct | MC60308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 172 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1A0M1 | 325-485 | TSYYSPLNHLKDAQGFAEKLFSRLQTCNERFEVKMMLMKVIARTVGLHHLILLNFYPYLQRYVQPHQRDVTNLLAAAVQACHDMVPP… |
| A0A4P9YP09 | 57-221 | NVISRVIGIHKLTLLSFYPFLFNYLNPHQQEVTLILTFAAQSTHELIPPEDIEAMVKTIANNFVADHCAPEVITVGLNSIREICSRN… |
| A0A077YVM6 | 452-662 | None |
| W9CHA8 | 332-496 | None |
| G5AQ37 | 96-268 | None |
| A0A2G9THV9 | 185-354 | None |
| A0A094E0I4 | 665-814 | None |
| A0A7S1BLH3 | 219-408 | None |
| K1X5S9 | 854-1018 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.