DPCstruct | MC60304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 130 ± 29 aa |
| Standard deviation of domain lengths | 29.37 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0322 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7WSP6 | 23-133 | FLLSLNSCGMYWMVLKDRIRDGYTPINAPSRYETDVIREFWNSTGDPMMTILLLLSKDGGSMHRQEYLNEAENLIQFMYTNFSVEHK… |
| A0A0N4X7D1 | 47-167 | RWPWTAIIICLIISGLSMVKILLTPQRNEITGYTPYGARAKDEFQEYQDFFSAQGLPVAPYLFVVAKDNGSMIRPEYMREAVEILNY… |
| A0A3P6QYM5 | 4-116 | None |
| J9AHV1 | 5-166 | None |
| A0A183HP12 | 4-111 | None |
| A0A0R3QDX4 | 39-155 | None |
| A0A5B7DUZ7 | 87-290 | None |
| A0A6V7WYF5 | 54-182 | None |
| A0A0N4W6L6 | 24-147 | None |
| A0A0B1TR24 | 13-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.