DPCstruct | MC60303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 153 ± 29 aa |
| Standard deviation of domain lengths | 28.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03836 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4JJA7 | 18-147 | KKGKKRFLMPFTKQWDHERELQRSGRIFKFGSYKYSARNLADRGVLVHWKGYTERQWDRVDLTISSNEVGVFMIDGSSGNMMVPGAN… |
| A0A1I7WK56 | 34-177 | SRYEEYIDTCLENLNRTSRRLSFRPNTKEAGKIQKKRQSLDVIQSFKSSADKLFRKGVLIDVLNPEYQNAKRITKLSVDIASTEKKG… |
| A0A5K3F3G7 | 1-118 | None |
| E4Y379 | 53-217 | None |
| A0A7S1G8A4 | 5-124 | None |
| A0A7S1SBM9 | 11-133 | None |
| A0A834BBY0 | 103-263 | None |
| A0A6S7G7P9 | 5-116 | None |
| A0A3Q0JAX8 | 28-156 | None |
| U6LAH0 | 211-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.