DPCstruct | MC60302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815IYL7 | 1-115 | MKPVDPNLPVVITWAYAQKEVAKAKGYNTTTTNLTKEQEDTQEKVLNLLPVLSEVNAISEELNKYRAFEIVVMPTASWEAVNVKGSK… |
| A0A267FBM7 | 6-111 | DKAKSSSAEDMLLMDDLVKLYPQVQEANAMSEELDRRVRFELVLMSPQGRGLRENEGRTEVYISLTNLDSGNEFFWSKDKFSDRKYL… |
| A0A183LSR4 | 80-210 | None |
| A0A816RXR4 | 124-234 | None |
| A0A1S3J029 | 48-152 | None |
| A0A5K3EQM3 | 116-231 | None |
| W2T1I4 | 139-267 | None |
| A0A817I248 | 95-205 | None |
| A9UT69 | 561-678 | None |
| A0A564Y9N1 | 326-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.