DPCstruct | MC603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HRJ6 | 72-197 | FPIFAYDGSLGGKYPVICVVLFNPANGTCFASFGAHPDFGVALERTVTELLQGRSLKDLDVFTPPTFDDEEVAEHANLETHFIDSSG… |
| A0A3D0X768 | 2-125 | KDCSLGGEYPVAGLLMIEKNTGKYGLKLGCHPDFGVAMERTLTEATQGGEITIYSNRSYMDFTNKSVYTPHNLMNSFATGKAQYPFQ… |
| A0A7X9EDQ5 | 18-148 | None |
| A0A848HQ63 | 388-517 | None |
| A0A1G3GW20 | 1-134 | None |
| A0A7C5GNU6 | 49-168 | None |
| A0A376VLP9 | 169-288 | None |
| A0A831R8U5 | 173-298 | None |
| A0A4Q2WSP5 | 3-125 | None |
| A0A1G5IHT2 | 58-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.